PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00141113001
Common NameGSBRNA2T00141113001, LOC106387136
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB_related
Protein Properties Length: 290aa    MW: 31621.3 Da    PI: 7.2728
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00141113001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-14143187347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  GSBRNA2T00141113001 143 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 187
                          8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.953287IPR017884SANT domain
SMARTSM007172.4E-63385IPR001005SANT/Myb domain
CDDcd001676.08E-63683No hitNo description
SuperFamilySSF466891.08E-93688IPR009057Homeodomain-like
PROSITE profilePS5129420.491136192IPR017930Myb domain
SuperFamilySSF466894.16E-17138192IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-17139191IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.6E-12140186IPR009057Homeodomain-like
SMARTSM007173.2E-13140190IPR001005SANT/Myb domain
PfamPF002495.0E-13143187IPR001005SANT/Myb domain
CDDcd001671.21E-11143188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MEILRPATTS HVSGGNWLME ETESNVPLAA SPDAATWTVA ENKAFENALA VYDDNTPDRW  60
QKVAAAISGK TVSDVIKQYN DLKADLSSIE AGLIPVPGYI TSPFTLDWAA GGGCDGFKPG  120
HPVGNKRSPA GRSPELERKK GVPWTEEEHK LFLMGLKKYG KGDWRNISRN FVITRTPTQV  180
ASHAQKYFIR QHSGGKDKRR ASIHDITTVN LQDEASLETS KSSIVAREQR SRLAAFPWSQ  240
TDNNGTHADA FNITIGNAIS GVHSYGQALL GPFNTVDSCY DAQNTMFQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-17371021176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00568DAPTransfer from AT5G58900Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00141113001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013682398.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_013682399.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_013682400.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-104DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078C8160.0A0A078C816_BRANA; BnaC03g12320D protein
STRINGBra006741.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.10.0Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]